SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013867277.1.9613 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013867277.1.9613
Domain Number 1 Region: 8-156
Classification Level Classification E-value
Superfamily Ribosomal protein S5 domain 2-like 0.00000000000000205
Family GHMP Kinase, N-terminal domain 0.0024
Further Details:      
 
Weak hits

Sequence:  WP_013867277.1.9613
Domain Number - Region: 270-319
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.00623
Family 4-(cytidine 5'-diphospho)-2C-methyl-D-erythritol kinase IspE 0.047
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013867277.1.9613
Sequence length 336
Comment hypothetical protein [Methanothermococcus okinawensis]; AA=GCF_000179575.2; RF=representative genome; TAX=647113; STAX=155863; NAME=Methanothermococcus okinawensis IH1; strain=IH1; AL=Complete Genome; RT=Major
Sequence
MVNIMKSKIISPSRIHMGLIDLNGSIGRVDGGIGITLNNPNFIIEGKESSDIEIEFDKNI
TDKNITNNEIEKRIYDISKKVLEYIGEKGIYLKIKSVIPQHSGLGSGTQMALSTGKLISL
IYQKELDSKTLSTITGRGGTSGIGVNAFEKGGFIVDGGHSFGKGKDKEDFRPSSASKNVR
APPVLFRHDFNWDVVLTIPKGESIYGNKEVDIFKKYCPIPLNETQKICHLILMKMMPAII
ENDISSFGEVVNKLQYIGFKKVELGLQKDIVKELLETLQKVSYSGLSSFGPTIYSICDGK
DSVKNVVETSKEFFDKYRIDGDIIITKGNNRGFDVK
Download sequence
Identical sequences F8ANV2
WP_013867277.1.9613 gi|336122096|ref|YP_004576871.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]