SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013874885.1.39566 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013874885.1.39566
Domain Number 1 Region: 8-178
Classification Level Classification E-value
Superfamily Prim-pol domain 1.77e-19
Family Bifunctional DNA primase/polymerase N-terminal domain 0.019
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013874885.1.39566
Sequence length 300
Comment DNA primase [Frankia symbiont of Datisca glomerata]; AA=GCF_000177615.2; RF=representative genome; TAX=656024; STAX=656024; NAME=Frankia symbiont of Datisca glomerata; strain=4085684; AL=Complete Genome; RT=Major
Sequence
MSGPAPALLAAAESYIEAGWPVFVLGRTKRPVANCPRCRDAGRDHDPEACACLSCHGFYA
ATLDLDRVAAMLSAAPRGLLAIRTGALAGLVVVDIDPGHGGRLDPALMTPTAAVASGGGG
WHLYYAHPGPPVLSRRLPGRTGVDVKADGGYVVAPPSIHPVTRTPYRWTARQTVGEMPPP
LHAAVTAPAAPSSQPTRPPATAGPPARRPTGGDDSAGGGISRPDLLLAAHLAAVARAPEG
HRRTTLYGAARGVARLVAADHLTATEAWAALADAGRAAAQTEREIRGAITGGFRDEGVPL
Download sequence
Identical sequences F8AVN4
gi|336179551|ref|YP_004584926.1| WP_013874885.1.39566

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]