SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013876480.1.15103 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013876480.1.15103
Domain Number 1 Region: 292-513
Classification Level Classification E-value
Superfamily P-loop containing nucleoside triphosphate hydrolases 3.09e-46
Family ABC transporter ATPase domain-like 0.0000445
Further Details:      
 
Domain Number 2 Region: 17-287
Classification Level Classification E-value
Superfamily DNA repair protein MutS, domain III 1.23e-30
Family DNA repair protein MutS, domain III 0.0071
Further Details:      
 
Domain Number 3 Region: 708-783
Classification Level Classification E-value
Superfamily SMR domain-like 0.00000000144
Family Smr domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013876480.1.15103
Sequence length 784
Comment endonuclease MutS2 [Parageobacillus thermoglucosidans]; AA=GCF_000178395.2; RF=na; TAX=634956; STAX=1426; NAME=Parageobacillus thermoglucosidasius C56-YS93; strain=C56-YS93; AL=Complete Genome; RT=Major
Sequence
MHTRVLHILEFDKVKEQLLEHVSSSLGKEKVEKLLPSSRLAEVVNWQEETDEAAAALRLR
GHVPLGGIVDIRASLKRVKIGGTLSPHELLDISSTISASRQLKQFIESLHEEKEEFPHLA
GYAEKLVALPEVQQAIERCIDDHGEVLDHASERLRSIRQQLRTTEARVREKLESIIRSPS
AQKMLSDAIITIRNDRYVIPVKQEYRGAYGGIVHDQSASGATLFIEPQAVVELNNQLQEA
RVKEKREIERILTELTGIVAGHAEALLENVGILAQLDFIFAKAKYANKLKATKPALNDRG
YIRLLQARHPLIDQEAVVPNDIELGKEYTTIVITGPNTGGKTVTLKTIGLLTLMAQAGLF
IPALDGSELAVFRSIYADIGDEQSIEQSLSTFSSHMVNIVEILRDVDHESLVLFDELGAG
TDPQEGAALAIAILDEVHGRGARTVATTHYPELKAYGYNRDGVINASVEFDTETLRPTYK
LLIGIPGRSNAFEISKRLGLAERIIERAKLHISAESNNVENMIASLEQSKKRAEEELKKA
EEARMEAEQLRRDWEQKWEELHEKREEIIEEAKRKAADIVRSSQQKAERIIHELRRMQQE
KQAEIKEHELIEAKKRLQEAMPTLEKKKKERKKQATHSFQPGDEVKVISLNQKGYLVEKV
SDDEWQVQLGILKMKINERDLEYIGSAPKTETKPLATVKGKDYHVGLELDLRGERYEDAL
ARLEKYIDDALLAGYPRVSIIHGKGTGALRKGVQEFLKTHRAVKSFHFGGANEGGTGVTI
VELK
Download sequence
Identical sequences WP_013876480.1.15103 gi|336234407|ref|YP_004587023.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]