SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013878740.1.76661 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013878740.1.76661
Domain Number 1 Region: 156-337
Classification Level Classification E-value
Superfamily SGNH hydrolase 8.86e-22
Family BT2961-like 0.071
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013878740.1.76661
Sequence length 340
Comment hydrolase GDSL [Halopiger xanaduensis]; AA=GCF_000217715.1; RF=representative genome; TAX=797210; STAX=387343; NAME=Halopiger xanaduensis SH-6; strain=SH-6; AL=Complete Genome; RT=Major
Sequence
MIGDHYPSVSLHNVAELAAPEWTADGDQLCRVPASVGAKLNVSARERVRGPTNSELRFVP
DGDDVEIEITLSAADRTRVWPFWGEFRPWEPFEIGPEPETHAFSVPERLARLEADAGADA
GRFDPRVCRLRFERAPSVALHGVSGDCRPPTADELPERRYLAYGTSITEGAASSAPHLNY
VSHVARGIDADVLNFGCSGSAYCEPAMADYLASRDDWDVATLALSVNMANRGFTVEQFRE
RADYFVNRIAAAHPEKPIACVTLFPYFADVIEGGDAQRAADFRAALREVVADSSHDTLSL
VEGAELMELTGLAADLLHPGDTGMEAIGEGLAAHLESRLE
Download sequence
Identical sequences F8DAN2
gi|336252613|ref|YP_004595720.1| WP_013878740.1.76661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]