SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013882502.1.66935 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_013882502.1.66935
Domain Number - Region: 89-127
Classification Level Classification E-value
Superfamily Phase 1 flagellin 0.00327
Family Phase 1 flagellin 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013882502.1.66935
Sequence length 132
Comment flagellar basal body rod protein FlgG [Cellulomonas gilvus]; AA=GCF_000218545.1; RF=representative genome; TAX=593907; STAX=11; NAME=Cellulomonas gilvus ATCC 13127; strain=ATCC 13127; AL=Complete Genome; RT=Major
Sequence
MSIFGAIGIAQSGLTVHRTWLDAVSDNLANISTVRPTSEAAFQARYVVAQETPGPEGGAQ
VVGAAFGSAEGRMVYEPANPLADENGYVRYPDIDMSSQMTQLIMAQRGYQANAAVVDRAK
ETYTAALQIGRS
Download sequence
Identical sequences F8A5G0
gi|336319577|ref|YP_004599545.1| WP_013882502.1.66935

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]