SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013890210.1.34921 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_013890210.1.34921
Domain Number - Region: 10-124
Classification Level Classification E-value
Superfamily BAR/IMD domain-like 0.0628
Family BAR domain 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013890210.1.34921
Sequence length 417
Comment BspA family leucine-rich repeat surface protein [Helicobacter bizzozeronii]; AA=GCF_000237285.1; RF=representative genome; TAX=1002804; STAX=56877; NAME=Helicobacter bizzozeronii CIII-1; strain=CIII-1; AL=Chromosome; RT=Major
Sequence
MQQVLENLEQELKSVKRAMRLAKSALEEGLEVQQEAQELHASFSAFMQVLGGALKALREH
YTSLKEDDLELEKSLTKLKHAQAKIATPLSVLEKPANAQEVLEVLEGLQNSVADLESVLE
GLHKSSQPTPQNFSTPKGAKKYCPQSKEELKKLVADESIHLGDIDISKITDLSYVFSESN
RKNFEGLETWDVSCANNMEGMFEKAIHFNHDISSWNVSRVENMKHMFCGCRCFNRSLDSW
NVSKVANMSHMFCGCENFNQSLDSWNVSSVTDMRGMLSGCKKFNQPLNSWNVSRVEDMGG
MFSFCSVFDQPLYGWNTSRVEDMGSMFAGCWNFNQLLDGWDVSSATSLQNMFGGCENFNQ
PLANWDTSSVANMSNMFNGCTRFNRPLDNWDVSNTEDMEGMFERCPSLTTLPHWYRA
Download sequence
Identical sequences F8KSH7
gi|336452992|ref|YP_004607458.1| WP_013890210.1.34921

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]