SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013904402.1.38058 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013904402.1.38058
Domain Number 1 Region: 17-377
Classification Level Classification E-value
Superfamily SIS domain 2.11e-51
Family double-SIS domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013904402.1.38058
Sequence length 389
Comment tagatose-6-phosphate ketose [Streptococcus parasanguinis]; AA=GCF_000164675.2; RF=representative genome; TAX=760570; STAX=1318; NAME=Streptococcus parasanguinis ATCC 15912; strain=ATCC 15912; AL=Complete Genome; RT=Major
Sequence
MLDYTKEDLQELGAEITSREIYQQPSVWKETARLYQERKAEIKAFLEKIGQEYDYIKVIL
TGAGTSAYVGDTLVPYLQEVHDERHWNFQSIATTDIVAHPQTYLKKEVPTVLVSFARSGN
SPESVATVQLAQDLVDELYQITITCAEEGKLAQQAHGDERNLLFLQPKETNDAGFAMTSS
FTSMLLTALLVFDPSEEEIKENRVSELVHLSEQILEKDREVKEVVDLDFERVIYLGAGPF
FGLAHEAQLKILELTAGKIATMYESPVGFRHGPKSLINDQTLVLVFGSIDPYTRQYDLDL
VREVAGDQIARQVVLLTDQVAGIEHVREVLVEASADSLDIYRAFPYIIYGQLISLLTSLK
VQNRPDTPSPTGTVNRVVQGVIIHSFHKE
Download sequence
Identical sequences F8DG74
gi|337283010|ref|YP_004622481.1| WP_013904402.1.38058

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]