SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013946657.1.98067 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013946657.1.98067
Domain Number 1 Region: 222-341
Classification Level Classification E-value
Superfamily TPR-like 0.00000000000905
Family Tetratricopeptide repeat (TPR) 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013946657.1.98067
Sequence length 349
Comment MULTISPECIES: tol-pal system protein YbgF [Hyphomicrobium]; AA=GCF_000253295.1; RF=na; TAX=717785; STAX=717785; NAME=Hyphomicrobium sp. MC1; strain=MC1; AL=Complete Genome; RT=Major
Sequence
MAKLAQIYSTGMGAFQAVALIAVMALSSGPLLSRPAMAQANDARGTKGGAAANASPDSAL
KARVDALEEQLVDMQVVVGTLETLAKNGGGGGGAASQPFPSAGSGADTARIESLETQVRA
LTAQVQQLTEQIQAQGGVQHRTDLPGGPDTASLGSGNGTPQAESAAIPGFGSTTVSPGNG
GNDAIGGLLNKQDQQGQANGWSSPPGAGVATAALPPASEASGDPKQAYETAYGYLLQRDY
GSAEASFNDFLKKYPNDSLAGNAQYWLGETYFVRGQYKAAAGAFLKGYQTYGQSGKAPDS
LLKLAMSLDRLGQKEAACSSFSELAAKFPTAPQSVKGRAQSERQRIGCQ
Download sequence
Identical sequences F8JIT1
WP_013946657.1.38999 WP_013946657.1.98067 gi|338737862|ref|YP_004674824.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]