SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013970310.1.23948 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013970310.1.23948
Domain Number 1 Region: 3-255
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 1.11e-37
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013970310.1.23948
Sequence length 260
Comment MULTISPECIES: zinc ABC transporter permease [Pseudomonas putida group]; AA=GCF_000510285.1; RF=na; TAX=1435044; STAX=76759; NAME=Pseudomonas monteilii SB3078; strain=SB3078; AL=Complete Genome; RT=Major
Sequence
MADFLLYALLAGLSLALVAGPLGSFVVWRRMAYFGDTLSHAALLGVALGFAMDVSPALAV
TVGCLLLAILLVTLQQRQPLASDTLLGILAPSTLSLGLVVLSFMHDVRIDLMAYLFGDLL
AISTTDLAWILGGSALVLLLLAALWRPLLAVTVHEELAMVEGLPVAGLRMALMLLIAVVI
AVAMKIVGVLLITSLLIIPAAAAQRHARSPEQMALGASLLGVTAVCGGLAMSWFKDTPAG
PSIVVCAAVLFLLSLALPKR
Download sequence
Identical sequences A0A059UTN8 A0A2A3LYC5 F8FUC0 V9VA84
gi|568184873|ref|YP_008957584.1| gi|568190243|ref|YP_008962944.1| gi|339485022|ref|YP_004699550.1| WP_013970310.1.23948 WP_013970310.1.28354 WP_013970310.1.35335 WP_013970310.1.56258 WP_013970310.1.65739 WP_013970310.1.7288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]