SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013970419.1.23948 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013970419.1.23948
Domain Number 1 Region: 60-285
Classification Level Classification E-value
Superfamily ARM repeat 3.67e-49
Family PBS lyase HEAT-like repeat 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013970419.1.23948
Sequence length 321
Comment MULTISPECIES: PBS lyase [Pseudomonas putida group]; AA=GCF_000510285.1; RF=na; TAX=1435044; STAX=76759; NAME=Pseudomonas monteilii SB3078; strain=SB3078; AL=Complete Genome; RT=Major
Sequence
MTERHIDNPDILELLPRLEAADAGVRRIALIELADLEDPLALPWLTDALLVDGADEVRAE
AARLLEAWEEPEVVQALCAALADSAETVRLAAAQSLSELKSQEAGQLILPWVGHADAFVR
ASALRALRELRLEDAARPALLALQDQDSAVRREAVAILGWLKHEPALPALAKLAEHEPDT
EVRRAAIGALGLARHSSVLPALIGALHDPAWQVREEAATTLGKVGHAQAGQALVDALGDD
FWQVRLRAARSLGRLRHAEALGALAGLLSHGIANLRKEAALALGELGLPRALPVLQAAEA
DSDPEVRKAVRIALAQLRGAV
Download sequence
Identical sequences A0A059UQY0 A0A2A3M2L8 F8FWY4 V9V7I4
gi|339485138|ref|YP_004699666.1| gi|568190354|ref|YP_008963057.1| WP_013970419.1.23948 WP_013970419.1.28354 WP_013970419.1.35335 WP_013970419.1.56258 WP_013970419.1.65739 WP_013970419.1.7288 gi|568184984|ref|YP_008957697.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]