SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013970618.1.61620 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013970618.1.61620
Domain Number 1 Region: 2-172
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 5.57e-54
Family Glyceraldehyde-3-phosphate dehydrogenase-like, N-terminal domain 0.0000458
Further Details:      
 
Domain Number 2 Region: 150-312
Classification Level Classification E-value
Superfamily Glyceraldehyde-3-phosphate dehydrogenase-like, C-terminal domain 1.57e-51
Family GAPDH-like 0.0000152
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013970618.1.61620
Sequence length 344
Comment MULTISPECIES: N-acetyl-gamma-glutamyl-phosphate reductase [Pseudomonas]; AA=GCF_002113785.1; RF=na; TAX=1981747; STAX=1981747; NAME=Pseudomonas sp. B12(2017); strain=B12(2017); AL=Scaffold; RT=Major
Sequence
MIKVGIVGGTGYTGVELLRLLAQHPQAEVAVITSRSEAGVAVADMYPNLRGHYDGLAFSV
PDSKTLAACDVVFFATPHGVAHALAGELLAAGTKVIDLSADFRLQDAAEWGKWYGQPHGA
PELLKDAVYGLPEVNREKIRQARLIAVPGCYPTATQLGFLPLLEAGLADPSRLIADCKSG
VSGAGRGAAVGSLFCEAGESMKAYAVKGHRHLPEISQGLRLAAGKDIGLTFVPHLTPMIR
GIHATLYATVADTSVDLQALFEKRYANEPFVDVMPAGSHPETRSVRGANVCRIAVHRPQG
GDLVVVLSVIDNLVKGASGQAVQNLNILFGLDERMGLSHAGLLP
Download sequence
Identical sequences A0A059UQ13 A0A099MUP4 A0A0C1KIK6 F8G0Z8 L0FC84 V7D3E9 V9UV75
gi|431800484|ref|YP_007227387.1| 2035935605 gi|568179987|ref|YP_008952502.1| gi|568185421|ref|YP_008957935.1| gi|339485365|ref|YP_004699893.1| WP_013970618.1.23948 WP_013970618.1.28354 WP_013970618.1.32670 WP_013970618.1.35335 WP_013970618.1.41505 WP_013970618.1.56258 WP_013970618.1.61620 WP_013970618.1.65739 WP_013970618.1.71677 WP_013970618.1.7288 WP_013970618.1.7435 WP_013970618.1.80759 WP_013970618.1.92076 WP_013970618.1.9402 WP_013970618.1.99927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]