SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013970664.1.28354 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013970664.1.28354
Domain Number 1 Region: 24-227
Classification Level Classification E-value
Superfamily OMPA-like 1.83e-29
Family Outer membrane protein 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013970664.1.28354
Sequence length 227
Comment MULTISPECIES: outer membrane protein W [Pseudomonas]; AA=GCF_000510325.1; RF=na; TAX=1435058; STAX=76759; NAME=Pseudomonas monteilii SB3101; strain=SB3101; AL=Complete Genome; RT=Major
Sequence
MNKSLLSAALAALALATPVANAHQAGDVIVRAGAITTAPNESSGDLKFDGNKVSGTKATL
DSDTQLGLTFAYMLTDHVGLELLAATPFKHTVGVKGLGGGLDGKLADIKQLPPTLSLQYY
PMEPTSKFQPYAGVGINYTLFFDEDLSSARKQQGFSNLKLQDSVGFAGQLGMDYMITDNL
LVNAAVWYVDIDTKASVDGPSALGYSKTKVDVDVDPWVYMVGLGYKF
Download sequence
Identical sequences A0A059UUW7 A0A099MSJ2 A0A0C1KNC7 F8G296 V7D7A0 V9UWN3
gi|339485438|ref|YP_004699966.1| gi|568180059|ref|YP_008952576.1| gi|568185493|ref|YP_008958009.1| WP_013970664.1.23948 WP_013970664.1.28354 WP_013970664.1.35335 WP_013970664.1.56258 WP_013970664.1.65739 WP_013970664.1.7288 WP_013970664.1.7435 WP_013970664.1.80759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]