SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013970698.1.61620 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013970698.1.61620
Domain Number 1 Region: 6-202
Classification Level Classification E-value
Superfamily Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 1.83e-59
Family Homo-oligomeric flavin-containing Cys decarboxylases, HFCD 0.0000164
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013970698.1.61620
Sequence length 209
Comment MULTISPECIES: aromatic acid decarboxylase [Pseudomonas]; AA=GCF_002113785.1; RF=na; TAX=1981747; STAX=1981747; NAME=Pseudomonas sp. B12(2017); strain=B12(2017); AL=Scaffold; RT=Major
Sequence
MSGPERITLAMTGASGAQYGLRLLDCLVREDREVHFLISKAAQLVMATETDVVLPAKPQA
MQAFLTEYTGAADGQIRVYGKEDWMSPVASGSGAPAAMVVVPCSTGTLSAIATGACNNLI
ERAADVTLKERRQLILVPREAPFSTIHLENMLKLSQMGAVILPAAPGFYHQPQTIDDLVD
FVVARILNLLNIPQDMLPRWGEHHFGVDD
Download sequence
Identical sequences A0A059UUZ7 A0A099MSW9 A0A0C1KN22 A0A0E9ZP51 A0A0M2UFT1 A0A136QH04 A0A1X7E5S2 F8G2D9 L0FFZ1 V7DH59 V9UVI0 V9WNV8
gi|431800605|ref|YP_007227508.1| WP_013970698.1.1643 WP_013970698.1.19780 WP_013970698.1.23948 WP_013970698.1.28354 WP_013970698.1.32670 WP_013970698.1.35335 WP_013970698.1.36363 WP_013970698.1.38888 WP_013970698.1.41 WP_013970698.1.41505 WP_013970698.1.42801 WP_013970698.1.52768 WP_013970698.1.56258 WP_013970698.1.57632 WP_013970698.1.61620 WP_013970698.1.65173 WP_013970698.1.65739 WP_013970698.1.675 WP_013970698.1.71677 WP_013970698.1.7288 WP_013970698.1.7435 WP_013970698.1.76210 WP_013970698.1.76710 WP_013970698.1.80759 WP_013970698.1.92076 WP_013970698.1.9402 WP_013970698.1.95946 WP_013970698.1.98117 WP_013970698.1.99927 gi|339485481|ref|YP_004700009.1| gi|568185536|ref|YP_008958052.1| gi|568180102|ref|YP_008952619.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]