SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013971572.1.80759 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013971572.1.80759
Domain Number 1 Region: 58-187,216-278
Classification Level Classification E-value
Superfamily ClpP/crotonase 4.2e-41
Family Clp protease, ClpP subunit 0.024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013971572.1.80759
Sequence length 329
Comment MULTISPECIES: signal peptide peptidase SppA [Pseudomonas]; AA=GCF_000831585.1; RF=na; TAX=70775; STAX=70775; NAME=Pseudomonas plecoglossicida; strain=NyZ12; AL=Complete Genome; RT=Major
Sequence
MADEWKAPEAEPEEREERKSWKLLEKTLLAGVQEQRRARRWGIFFKLLTFVYLFGILILF
TPLMDMDKAASRSASHTALVEVRGVIADQEPASADNIVKSLREAFKDSKTKAVVMRINSP
GGSPVQSGYVYDEIRRLRAEYPAIKLYAVIADLGASGAYYIASAADEIYADKASLVGSIG
VTAAGYGFVGTMEKLGVERRTYTAGEHKAFLDPFSPQKPEETEFWQGVLNTTHQQFIAMV
KQGRGERLKDKEHPELFSGLVWSGEQAKELGLVDGLGSASYVAREIVGEKELVDFTVQES
ALDRFSKRVGASVAERLAMWMGFQGPQLR
Download sequence
Identical sequences A0A059UQY1 A0A099MYD2 A0A1L5PLG4 F8FS46 V7D4T4 V9UW56
WP_013971572.1.1643 WP_013971572.1.23948 WP_013971572.1.28354 WP_013971572.1.35335 WP_013971572.1.56258 WP_013971572.1.59340 WP_013971572.1.65739 WP_013971572.1.7288 WP_013971572.1.80759 gi|339486468|ref|YP_004700996.1| gi|568180958|ref|YP_008953491.1| gi|568186389|ref|YP_008958920.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]