SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_013971594.1.9402 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013971594.1.9402
Domain Number 1 Region: 78-177
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 6.6e-23
Family Tetracyclin repressor-like, C-terminal domain 0.0000198
Further Details:      
 
Domain Number 2 Region: 1-72
Classification Level Classification E-value
Superfamily Homeodomain-like 1.08e-16
Family Tetracyclin repressor-like, N-terminal domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013971594.1.9402
Sequence length 179
Comment MULTISPECIES: TetR family transcriptional regulator [Pseudomonas]; AA=GCF_002113565.1; RF=na; TAX=1981715; STAX=1981715; NAME=Pseudomonas sp. B4(2017); strain=B4(2017); AL=Scaffold; RT=Major
Sequence
MSDKKSRTRERILEAARSALIQHGPAEPSVSQVMGAAGLTVGGFYAHFDSKDELMLEAFR
QLLGERRALLAQIDPSLDGAGRRALASAFYLSRKHRDAEVHACPLPNSLGEMQRLPEAFR
EVLAEHIELMAAAMVDRPEDADKALADLALMVGGLALARALGTSELSDRILRAAKSAVL
Download sequence
Identical sequences A0A059UTN1 A0A099MXZ7 F8FS71 L0FI67 V7DHR7 V9UZB4 V9WWW0
gi|568186413|ref|YP_008958945.1| gi|568180982|ref|YP_008953516.1| gi|431801471|ref|YP_007228374.1| gi|339486493|ref|YP_004701021.1| WP_013971594.1.1643 WP_013971594.1.23948 WP_013971594.1.28354 WP_013971594.1.32670 WP_013971594.1.35335 WP_013971594.1.41505 WP_013971594.1.52768 WP_013971594.1.56258 WP_013971594.1.57632 WP_013971594.1.61620 WP_013971594.1.65739 WP_013971594.1.71677 WP_013971594.1.7288 WP_013971594.1.76210 WP_013971594.1.76710 WP_013971594.1.80759 WP_013971594.1.92076 WP_013971594.1.9402 WP_013971594.1.95946 WP_013971594.1.99927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]