SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013971711.1.65739 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013971711.1.65739
Domain Number 1 Region: 2-308
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.56e-66
Family Crotonase-like 0.000000000151
Further Details:      
 
Domain Number 2 Region: 314-496
Classification Level Classification E-value
Superfamily NAD(P)-binding Rossmann-fold domains 5.64e-57
Family 6-phosphogluconate dehydrogenase-like, N-terminal domain 0.0000000914
Further Details:      
 
Domain Number 3 Region: 496-608
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 2.98e-30
Family HCDH C-domain-like 0.000000775
Further Details:      
 
Domain Number 4 Region: 622-714
Classification Level Classification E-value
Superfamily 6-phosphogluconate dehydrogenase C-terminal domain-like 1.02e-23
Family HCDH C-domain-like 0.00000273
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013971711.1.65739
Sequence length 715
Comment MULTISPECIES: multifunctional fatty acid oxidation complex subunit alpha [Pseudomonas putida group]; AA=GCF_001027965.1; RF=na; TAX=303; STAX=303; NAME=Pseudomonas putida; strain=SF1; AL=Contig; RT=Major
Sequence
MIYEGKAITVKALESGIVELKFDLKGESVNKFNRLTLNELRQAVDAIKADASVKGVIVSS
GKDVFIVGADITEFVDNFKLPEAELVAGNLEANRIFNAFEDLEVPTVAAINGIALGGGLE
MCLAADYRVMSTSAKIGLPEVKLGIYPGFGGTVRLPRLIGSDNAIEWIAAGKENRAEDAL
KVGAVDAVVAPQLLMAGALDLVKRAISGELDYKAKRQPKLEKLKLNAIEQMMAFETAKGF
VAGQAGPNYPAPVEAIKTIQKAANFGRDKALEVEAAGFAKLAKTSVAESLIGLFLNDQEL
KRKAKAHDEIAHDVKQAAVLGAGIMGGGIAYQSAVKGTPILMKDIREEAIQLGLNEASKL
LGNRVEKGRLTPAKMAEALNAIRPTLSYGDFANVDIVVEAVVENPKVKQAVLAEVEAQVK
DDAILASNTSTISINLLAKALKRPENFVGMHFFNPVHMMPLVEVIRGEKSSEVAVATTVA
YAKKMGKNPIVVNDCPGFLVNRVLFPYFGGFAKLVSAGVDFVRIDKVMEKFGWPMGPAYL
MDVVGIDTGHHGRDVMAEGFPDRMKDERRSAVDALYEANRLGQKNGKGFYAYETDKRGKP
KKVADATVLDVLKPIVFEQREVTDEDIINWMMIPLCLETVRCLEDGIVETAAEADMGLVY
GIGFPPFRGGALRYIDSIGVAEFVALADQYADLGPLYHPTAKLREMAKNGQRFFN
Download sequence
Identical sequences A0A059UVB7 F8FUP1 V9UWL3
gi|568186549|ref|YP_008959084.1| gi|339486624|ref|YP_004701152.1| gi|568181118|ref|YP_008953655.1| WP_013971711.1.23948 WP_013971711.1.28354 WP_013971711.1.35335 WP_013971711.1.56258 WP_013971711.1.65739 WP_013971711.1.7288

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]