SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013971741.1.1643 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013971741.1.1643
Domain Number 1 Region: 6-106
Classification Level Classification E-value
Superfamily SpoIIaa-like 0.0000000000000981
Family Anti-sigma factor antagonist SpoIIaa 0.007
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013971741.1.1643
Sequence length 160
Comment MULTISPECIES: anti-anti-sigma factor [Gammaproteobacteria]; AA=GCF_001586765.1; RF=na; TAX=1636605; STAX=1636605; NAME=Pseudomonas sp. ABFPK; strain=ABFPK; AL=Contig; RT=Major
Sequence
MSTGRIQFAEQSGTFVLKFVGEVRLTLCSALDATIEKIFTALNFSAIVIDLTETESIDST
TLGLLAKLSILSRQKVGLLPTVVTTNPDISRLLQSMGFDQVFNIVDRPIPCPECLTDLPS
QDQNEDVVRSKVLEAHKILMGLNDSNREAFHDLVNALERT
Download sequence
Identical sequences A0A059UU63 A0A077FC38 A0A099MWC7 A0A0C1KE60 A0A0C5RV60 A0A0M2UJQ2 A0A132G5U1 A0A136Q9L3 A0A1L5PL72 F8FUS3 L0FH44 R9V0V9 V7DFQ3 V9UXC9 V9WX96
gi|431801642|ref|YP_007228545.1| gi|568181149|ref|YP_008953686.1| 2035964850 gi|512577438|ref|YP_008093420.1| gi|339486656|ref|YP_004701184.1| gi|568186580|ref|YP_008959115.1| WP_013971741.1.1467 WP_013971741.1.1643 WP_013971741.1.17209 WP_013971741.1.23948 WP_013971741.1.28354 WP_013971741.1.29846 WP_013971741.1.32670 WP_013971741.1.35335 WP_013971741.1.36363 WP_013971741.1.41505 WP_013971741.1.42658 WP_013971741.1.52768 WP_013971741.1.56258 WP_013971741.1.57632 WP_013971741.1.59340 WP_013971741.1.61620 WP_013971741.1.62999 WP_013971741.1.65739 WP_013971741.1.66754 WP_013971741.1.68951 WP_013971741.1.71677 WP_013971741.1.7288 WP_013971741.1.7435 WP_013971741.1.76210 WP_013971741.1.76632 WP_013971741.1.76710 WP_013971741.1.79655 WP_013971741.1.80759 WP_013971741.1.87386 WP_013971741.1.92076 WP_013971741.1.9402 WP_013971741.1.95946 WP_013971741.1.97771 WP_013971741.1.98117 WP_013971741.1.99808 WP_013971741.1.99927

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]