SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013972469.1.7288 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013972469.1.7288
Domain Number 1 Region: 3-368
Classification Level Classification E-value
Superfamily FMN-linked oxidoreductases 1.34e-91
Family FMN-linked oxidoreductases 0.0000143
Further Details:      
 
Domain Number 2 Region: 346-650
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 4.53e-30
Family FAD-linked reductases, N-terminal domain 0.053
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013972469.1.7288
Sequence length 650
Comment MULTISPECIES: oxidoreductase [Pseudomonas putida group]; AA=GCF_000764405.1; RF=na; TAX=70775; STAX=70775; NAME=Pseudomonas plecoglossicida; strain=TND35; AL=Scaffold; RT=Major
Sequence
MQTAFPHLFEALQIRGKRLKNRIMSTGHDTCLPTDNLVNDKLIAYQRARAAGGVGLIVLQ
VAGVHDSARYTSHVLMATDDACIDGYRQLAEACHEHGTVVLSQLFHPGREIMESADGLLA
VAYSASAVPNERFRVMPRALDQAMIDEIVQGYASAARRLHQAGLDGVEVVASHGYLPAQF
LNPRVNQRSDGYNGELEQRLRFLREVLAAVRAATDEQFIIGLRISADERDSQGLSEDESL
AAAVALQGQLDYLHIVAGTSASLGGAVHIVPPMAIQPAYLAREAGTFKQHLGIPLFVTGR
INQPQEAELILARGQADVCGMTRALICDPQMPNKTEHGQVEDVRACIACNQACIGHFHRG
LPISCIQRPETGRELQYEQLPPTTRPKRILVAGGGPAGMKAAAVAAARGHQVTLYEAGPQ
LGGQVLLAQLLPRRSEFGGASTNLQREMALAGVEVVRNTRVDRALVERERPDLVIAATGA
TPYWPAFERTGDLQVVDAWQILRSEAKPGRSVLVIDWRCDWIGPGIAERLVRDGHQVQLA
VNGTHCGESLPLYVRDQLAGELHRLGIPITPYARLYGCDDNTVYLQHTASGEPMIFEGID
TLVLCQGHQPEDRLATELAGLVEVRRIGDCLAPRTAEEAIHDGLTVAWAL
Download sequence
Identical sequences A0A059USF1 A0A099N0P5 F8FSF6 V7D487 V9UXL3
gi|568182052|ref|YP_008954660.1| WP_013972469.1.23948 WP_013972469.1.28354 WP_013972469.1.35335 WP_013972469.1.56258 WP_013972469.1.7288 WP_013972469.1.80759 gi|339487446|ref|YP_004701974.1| gi|568187432|ref|YP_008960030.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]