SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013972608.1.28354 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013972608.1.28354
Domain Number 1 Region: 1-263
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.46e-84
Family Crotonase-like 0.0000549
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013972608.1.28354
Sequence length 263
Comment MULTISPECIES: 2-(1,2-epoxy-1,2-dihydrophenyl)acetyl-CoA isomerase [Pseudomonas]; AA=GCF_000510325.1; RF=na; TAX=1435058; STAX=76759; NAME=Pseudomonas monteilii SB3101; strain=SB3101; AL=Complete Genome; RT=Major
Sequence
MTFQHILFSIEDGVALLSLNRPEQLNSFNTAMHLEVREALKQVRQSSEARVLLLTAEGRG
FCAGQDLSDRNVAPGAEMPDLGESIDKFYNPLVRTLRDLPLPVVCAVNGVAAGAGANIPL
ACDLVLAARSASFIQAFCKIGLVPDSGGTWLLPRLVGMARAKALAMLGERLGAEQAQQWG
LIHRVVDDAALRDEALTLARQLATQPTYGLALIKRSLNASFDNGFDEQLELERDLQRLAG
RSEDYREGVSAFMNKRTPAFKGR
Download sequence
Identical sequences A0A099N146 A0A1L5PQY0 F8FUY8 V7D5P6 V9UZQ9
gi|568182246|ref|YP_008954862.1| gi|568187624|ref|YP_008960230.1| gi|339487591|ref|YP_004702119.1| WP_013972608.1.23948 WP_013972608.1.28354 WP_013972608.1.36363 WP_013972608.1.56258 WP_013972608.1.59340 WP_013972608.1.65739 WP_013972608.1.7288 WP_013972608.1.80759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]