SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013972815.1.7288 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013972815.1.7288
Domain Number 1 Region: 155-313
Classification Level Classification E-value
Superfamily TPR-like 7.78e-26
Family Tetratricopeptide repeat (TPR) 0.0021
Further Details:      
 
Domain Number 2 Region: 63-146
Classification Level Classification E-value
Superfamily ARM repeat 0.00000113
Family Leucine-rich repeat variant 0.073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013972815.1.7288
Sequence length 351
Comment MULTISPECIES: hypothetical protein [Pseudomonas putida group]; AA=GCF_000764405.1; RF=na; TAX=70775; STAX=70775; NAME=Pseudomonas plecoglossicida; strain=TND35; AL=Scaffold; RT=Major
Sequence
MHRRNRYLIALLLLILVSALFGYLWRDAPPAPPTLPAHSYAKALRQAHEGQPGAARVLYQ
QLQRTDLPPIRRAALYAELPNYPSPQALKLARQDLEHADPQVRRAAIAGIRRLLPAAQRS
LVLGPLLDDDEQSVRFAAVDALLGLAPDDIGLYFGPLQVALEQYQQALEQQPEDADAQVH
LARLYLHENDYTLADTALQRALAVAPGNLDALATQVRLLERQGYHDASRQILGKALALSP
DSAFLQYELGLWLNRHEQREYALLALSRAVELDPDNADYRYTLAVTLHELEQLDAAQKQL
EIVLNRQPANRRARVLLIKYWKETGQLQNVQVLLAELERQNPDDPVLQQGL
Download sequence
Identical sequences A0A099N227 F8FYZ2 V7D6A7 V9V120
gi|568182457|ref|YP_008955081.1| gi|339487809|ref|YP_004702337.1| WP_013972815.1.23948 WP_013972815.1.28354 WP_013972815.1.56258 WP_013972815.1.7288 WP_013972815.1.80759 gi|568187835|ref|YP_008960449.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]