SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013972907.1.56258 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013972907.1.56258
Domain Number 1 Region: 2-313
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 2.82e-101
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.00000000441
Further Details:      
 
Domain Number 2 Region: 316-458
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 1.18e-38
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.0000101
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013972907.1.56258
Sequence length 460
Comment MULTISPECIES: cysteine--tRNA ligase [Pseudomonas putida group]; AA=GCF_000219705.1; RF=na; TAX=1042876; STAX=303; NAME=Pseudomonas putida S16; strain=S16; AL=Complete Genome; RT=Major
Sequence
MLTIYNTLSKTKETFKPLDGNKVRMYVCGMTVYDYCHLGHGRSMVAFDLVTRWLRKSGYE
LTYVRNITDIDDKIINRANENGESFDALTARMIDAMHEDERRLNILPPDQEPRATDHIAG
MHAMIQTLIDKGYAYAPGNGDVYYRVGKFVGYGKLSRKKIEDLRIGARIEVDEAKQDPLD
FVLWKGVKPGEPSWESPWGPGRPGWHIECSVMSTCCLGESFDIHGGGSDLEFPHHENEIA
QSEAATGKQYANAWMHCGMIRINGEKMSKSLNNFFTIRDVLEKYHPEVVRYLLVASHYRS
AINYSEDSLRDAKGALERFYHALRGLPRVAAKGGEEFVERFSVAMNDDFGTPEACAVLFD
LVREINRLRESDVEAAAGLAGRLRELGDVLGVLQLEADDFLRAGAEGKVDAAEVEGLIQA
RLQARADKNWAESDRIRDQLTAMGVVLEDGKGGTTWRLAD
Download sequence
Identical sequences A0A059UT72 A0A099N2A1 A0A136QEN7 F8G0D2 L0FIU0 V7DDK5 V9V296
gi|339487907|ref|YP_004702435.1| gi|568187931|ref|YP_008960550.1| gi|431802924|ref|YP_007229827.1| gi|568182553|ref|YP_008955182.1| WP_013972907.1.23948 WP_013972907.1.28354 WP_013972907.1.35335 WP_013972907.1.56258 WP_013972907.1.57632 WP_013972907.1.65739 WP_013972907.1.71677 WP_013972907.1.7288 WP_013972907.1.80759

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]