SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013973085.1.35335 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013973085.1.35335
Domain Number 1 Region: 86-201
Classification Level Classification E-value
Superfamily Tetracyclin repressor-like, C-terminal domain 8.34e-17
Family Tetracyclin repressor-like, C-terminal domain 0.0074
Further Details:      
 
Domain Number 2 Region: 7-86
Classification Level Classification E-value
Superfamily Homeodomain-like 7.48e-16
Family Tetracyclin repressor-like, N-terminal domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013973085.1.35335
Sequence length 214
Comment MULTISPECIES: TetR family transcriptional regulator [Pseudomonas putida group]; AA=GCF_000691565.1; RF=na; TAX=303; STAX=303; NAME=Pseudomonas putida; strain=DLL-E4; AL=Complete Genome; RT=Major
Sequence
MNQEARYHRMLPELRKANLVEATLVCLKRHGFQGASIRKISAEAGVSVGLISHHYAGKDE
LVAEAYMAVTGRVMGLLREAMAQAAPNARERLSAFFRASFCAELLDPQLLDAWLAFWGAV
KTADAINQVHDHSYGEYRNELSGLLATLAGEEGWQGFDADLAAISLSALLDGLWLESGLN
PGTFTPDQGVLICEAWVDGLQAGGRRRFSLPEGC
Download sequence
Identical sequences A0A059UYD4 A0A099N0M0 F8G341 V9UZG3
gi|568182744|ref|YP_008955376.1| gi|568188122|ref|YP_008960744.1| WP_013973085.1.23948 WP_013973085.1.28354 WP_013973085.1.35335 WP_013973085.1.56258 WP_013973085.1.65739 WP_013973085.1.7288 WP_013973085.1.80759 gi|339488098|ref|YP_004702626.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]