SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013973086.1.56258 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013973086.1.56258
Domain Number 1 Region: 2-246
Classification Level Classification E-value
Superfamily ClpP/crotonase 1.12e-64
Family Crotonase-like 0.0000856
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013973086.1.56258
Sequence length 248
Comment MULTISPECIES: enoyl-CoA hydratase [Pseudomonas putida group]; AA=GCF_000219705.1; RF=na; TAX=1042876; STAX=303; NAME=Pseudomonas putida S16; strain=S16; AL=Complete Genome; RT=Major
Sequence
MNDLITRDLDQGLLTLSFNRPDKLNAVNTAMYQQLGDLLLAAGEDPDVEAIIITGGPQCF
TAGNDLRDFLDNPPADLDSPVFRLMRVVMGLDKPLIAAVSGAAIGIGATLLLHCDQVLVS
RTTKLRIPFAPLGVCPEFGSSLLLPRLLGPARAARLLLANELLDGERMVAWGLANELHDD
GEQCLAAARRLARQLQGYPQAALRISKRLLKDGQRAELEATVAREARLFIECLRTEEARA
VLRGLIKD
Download sequence
Identical sequences A0A059V313 F8G342 V9V455
gi|568188123|ref|YP_008960745.1| WP_013973086.1.23948 WP_013973086.1.28354 WP_013973086.1.35335 WP_013973086.1.56258 WP_013973086.1.65739 WP_013973086.1.7288 gi|568182745|ref|YP_008955377.1| gi|339488099|ref|YP_004702627.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]