SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013974613.1.76710 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013974613.1.76710
Domain Number 1 Region: 114-455
Classification Level Classification E-value
Superfamily Nucleotidylyl transferase 3.71e-91
Family Class I aminoacyl-tRNA synthetases (RS), catalytic domain 0.00000217
Further Details:      
 
Domain Number 2 Region: 456-578
Classification Level Classification E-value
Superfamily Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 1.5e-33
Family Anticodon-binding domain of a subclass of class I aminoacyl-tRNA synthetases 0.00053
Further Details:      
 
Domain Number 3 Region: 2-101
Classification Level Classification E-value
Superfamily Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain 2.75e-23
Family Arginyl-tRNA synthetase (ArgRS), N-terminal 'additional' domain 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013974613.1.76710
Sequence length 578
Comment MULTISPECIES: arginine--tRNA ligase [Pseudomonas]; AA=GCF_002113085.1; RF=na; TAX=1981734; STAX=1981734; NAME=Pseudomonas sp. B24(2017); strain=B24(2017); AL=Scaffold; RT=Major
Sequence
MKDTIRQLIQQALTQLVTDGVLPEGLSPAIQVENARDKTHGDFASNIAMMLAKPAGMKPR
DLAEKLINALPASADISKVEIAGPGFLNFFQNTDALANRLDAALADAHLGARKAGPAQKV
VIDMSAPNLAKEMHVGHLRSTIIGDSVARVLEFLGDDVIRQNHVGDWGTQFGMLLAYLEE
NPITSDELSDLENFYRAAKKRFDESEEFATRARGLVVKLQAGDPDCMALWTRFKDISLSH
CQKTYELLNVKLTMADVMGESAYNDDLANVVADLKAKGLLVEDQGAQCVFLDEFKNSEGE
PLPVIVQKADGGYLYATTDLAAVRYRSNVLKADRALYFVDQRQALHFNQVFEVARRAGFV
GHPMQMEHMGFGTMNGADGRPFKTRDGGTVKLIDLLTEAKERAYALVKEKNPSLADEELR
HIGEVVGIGAVKYADLSKHRTSDYSFNFELMLNFEGNTAPYLLYAYTRVAGVFRKLGKGF
DEVDGNIVLQAAHEQDLAARLAQFGEILNNVADKGTPHVLCSYLYDLAGLFSSFYENCPI
LAAETPQQQQSRLRLAALTGRTLKQGLELLGLETLERM
Download sequence
Identical sequences A0A099N5M2 A0A0C1I3H9 A0A0P7DK13 A0A136QE15 A0A1L5PXD0 F8FWR5 L0FRF0 V7DCT7 V9V4A8
WP_013974613.1.23948 WP_013974613.1.28354 WP_013974613.1.32670 WP_013974613.1.41505 WP_013974613.1.52768 WP_013974613.1.56258 WP_013974613.1.57632 WP_013974613.1.59340 WP_013974613.1.65739 WP_013974613.1.71677 WP_013974613.1.7288 WP_013974613.1.7435 WP_013974613.1.76710 WP_013974613.1.80759 WP_013974613.1.95946 WP_013974613.1.99927 gi|339489813|ref|YP_004704341.1| gi|568189807|ref|YP_008962495.1| gi|431804912|ref|YP_007231815.1| gi|568184434|ref|YP_008957132.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]