SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013974826.1.23948 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_013974826.1.23948
Domain Number - Region: 7-74
Classification Level Classification E-value
Superfamily ABC transporter involved in vitamin B12 uptake, BtuC 0.0235
Family ABC transporter involved in vitamin B12 uptake, BtuC 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013974826.1.23948
Sequence length 81
Comment MULTISPECIES: GlsB/YeaQ/YmgE family stress response membrane protein [Pseudomonas putida group]; AA=GCF_000510285.1; RF=na; TAX=1435044; STAX=76759; NAME=Pseudomonas monteilii SB3078; strain=SB3078; AL=Complete Genome; RT=Major
Sequence
MGIIGTIFIGLIVGLLARFIKPGDDSMGWIMTILLGIAGSLLATYGGQALGIYQAGQAAG
FLGALVGAVILLLIYGFIKKR
Download sequence
Identical sequences A0A059V6F1 A0A099N8T8 F8G0U7 V7DFR8 V9V513
gi|568184679|ref|YP_008957382.1| WP_013974826.1.23948 WP_013974826.1.28354 WP_013974826.1.35335 WP_013974826.1.56258 WP_013974826.1.65739 WP_013974826.1.7288 WP_013974826.1.80759 gi|339490061|ref|YP_004704589.1| gi|568190052|ref|YP_008962745.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]