SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013984263.1.85630 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013984263.1.85630
Domain Number 1 Region: 12-205
Classification Level Classification E-value
Superfamily ClpP/crotonase 4.5e-28
Family Clp protease, ClpP subunit 0.022
Further Details:      
 
Domain Number 2 Region: 378-444
Classification Level Classification E-value
Superfamily NfeD domain-like 0.00000000116
Family NfeD domain-like 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013984263.1.85630
Sequence length 458
Comment serine protease [Pseudomonas stutzeri]; AA=GCF_000219605.1; RF=representative genome; TAX=316; STAX=316; NAME=Pseudomonas stutzeri; strain=CGMCC 1.1803; AL=Complete Genome; RT=Major
Sequence
MPRHPARWLLALLLALAVQSASAADPVTLLRVDGAIGPASADYILRGLQHARDEGAQLVV
LELDTPGGLDTSMRAIIKAILASPIPVATYVTPSGARAASAGTYMLYASHVAAMAPGTNL
GAATPVQIGGMPGAPPEQPKGEREDDAKASGDALARKQVNDAAAYIRGLAQLRERNAEWA
EQAVREAVSLSASEALKLKVIDYLARDVADLLRQLDGKTLATIEGEVRLQTADARLIEHA
PDWRVRLLAVITNPSVALILMMIGIYGLILEFSNPGMGAGGVLGGICLILALYALQLLPV
NYAGVALILLGIAFMVAEAFLPSFGVLGIGGVAAFVAGAVILIDTEVPGFGIPLSLIVPL
GFASALLVFAIVAMALKARRQRLVGGDAELIGSLAPVTGISAQDPHSGWVHLQGENWQVR
SATPLQVGQQVRVVAREGLQLNVAAQPSSNREELNHGL
Download sequence
Identical sequences A0A1G3DAN7 F8H3Y7
gi|339495918|ref|YP_004716211.1| WP_013984263.1.54801 WP_013984263.1.85630 WP_013984263.1.9384

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]