SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013992349.1.92583 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013992349.1.92583
Domain Number 1 Region: 11-108
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 1.69e-19
Family DNA-binding N-terminal domain of transcription activators 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013992349.1.92583
Sequence length 109
Comment transcriptional regulator [Zobellia galactanivorans]; AA=GCF_002211465.1; RF=na; TAX=63186; STAX=63186; NAME=Zobellia galactanivorans; strain=OII3; AL=Contig; RT=Major
Sequence
MQVDLPEKRYYGIGEVAKAFGVNTSLIRFWEKEFDALKPKKNAKGNRKFTPQDINNLKLI
YHLVKERGFTLEGAKTHLKENRQKTLNNFDIIDKLERIKAELTKIKDQL
Download sequence
Identical sequences G0L2K2
gi|340616975|ref|YP_004735428.1| WP_013992349.1.92583 WP_013992349.1.951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]