SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013992785.1.951 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013992785.1.951
Domain Number 1 Region: 9-116,145-416
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 3.93e-111
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.000000134
Further Details:      
 
Domain Number 2 Region: 400-504
Classification Level Classification E-value
Superfamily Class II aaRS ABD-related 1.22e-32
Family Anticodon-binding domain of Class II aaRS 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013992785.1.951
Sequence length 516
Comment glycine--tRNA ligase [Zobellia galactanivorans]; AA=GCF_000973105.1; RF=representative genome; TAX=63186; STAX=63186; NAME=Zobellia galactanivorans; strain=DsiJT; AL=Complete Genome; RT=Major
Sequence
MAKQEDDFKKVISHAKEYGYVFQSSEIYDGLSAVYDYAQNGAELKKNIREYWWKAMVQLN
DNIVGIDAAIFMHPTTWKASGHVDAFNDPLIDNKDSKKRYRADVLVEDHVAKIEAKIEKE
VAKAAKRFGDKFDKEQFLATNQRVVDYQEQATAILKRLGRSLENEDLADVKKLIEELDIA
CPMSGSKNWTEVKQFNLMFGTKLGATADSAMDLYLRPETAQGIFVNFLNVQKTGRMKIPF
GIAQTGKAFRNEIVARQFIFRMREFEQMEMQYFIKPGTQQEWYEKWKENRMKWHLSLGLG
EDNYRFHDHEKLAHYADAAADIEFRFPFGFKELEGIHSRTDFDLSSHEKFSGKKLQYFDP
ETRESYVPYVLETSIGLDRMFLAVFSNSLVEEELENGSTRTVLKLPAVLAPTKAAILPLV
KKDGLPEVAHEIIEDLKWDFNVTYDEKDAVGRRYRRQDANGTPFCITVDHQTLEDRTVTI
RHRDSMEQERVSISSLKEIIHKAVDMKTWLMKMQKL
Download sequence
Identical sequences G0LAL6
WP_013992785.1.92583 WP_013992785.1.951 gi|340617411|ref|YP_004735864.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]