SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013993055.1.92583 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013993055.1.92583
Domain Number 1 Region: 3-199,252-403
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.16e-73
Family C5 cytosine-specific DNA methylase, DCM 0.0000527
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_013993055.1.92583
Sequence length 408
Comment DNA (cytosine-5-)-methyltransferase [Zobellia galactanivorans]; AA=GCF_002211465.1; RF=na; TAX=63186; STAX=63186; NAME=Zobellia galactanivorans; strain=OII3; AL=Contig; RT=Major
Sequence
MSKLKAIELFAGVGGFRLGLEKTGQYEVVWSNQWEPSTKTQHASIVYEARFGKANHCNKD
IAEVPTDAIPDADLLVGGFPCQDYSVATTLQNSKGLIGKKGVLWWSIHRILSEKKNPPKY
LFLENVDRLLKSPSAQRGRDFAIMLKSLDDLGYAVEWRVINAADYGMPQRRRRIFFLGYH
KSTPLYNALKKSDAADWVHTSGTMPAAFPVQQTVQKPTSFEIEGDLVHISENFNLGEGLS
PFQNSGVFIDGKVFTVKTAPSYDGKRTVLGDVLQNGEVTEAFFIPEEDYPKWEYLKGAKK
EVRTAKSGFTYNYSEGGMIFPDALDNASRTIITGEGGKSPSRFKHVVQTKKGLRRLTPIE
LERLNMFPDNHTLLEGISDTKRAFFMGNALVVGVVEKIAEALADKIEV
Download sequence
Identical sequences G0LAZ3
WP_013993055.1.92583 WP_013993055.1.951 gi|340617682|ref|YP_004736135.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]