SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013995711.1.951 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013995711.1.951
Domain Number 1 Region: 36-163
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 2.47e-17
Family CAC2371-like 0.067
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013995711.1.951
Sequence length 234
Comment methyltransferase [Zobellia galactanivorans]; AA=GCF_000973105.1; RF=representative genome; TAX=63186; STAX=63186; NAME=Zobellia galactanivorans; strain=DsiJT; AL=Complete Genome; RT=Major
Sequence
MADFLKRNRETELMDDLSLDETRLNAVLLDIDRANRLLNGNNLTIKAVEALISEHPKESY
TILDMGCGNGSMLRSVVLWARKRKISIACMGVDLNGKSLALAREQSRDFPEIIYLQQDIL
ALRPDELPCDILLCTLTMHHFKDEEIPRFLDQFSKLGRIGFIINDLQRSVWAYYLFKLFS
TIFIRTDIAKQDGLTSIKSGFVKGELEAFAEKLPQMRHSIEQKWAFRYLWLAQH
Download sequence
Identical sequences G0L3N1
WP_013995711.1.92583 WP_013995711.1.951 gi|340620349|ref|YP_004738802.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]