SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013995891.1.951 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013995891.1.951
Domain Number 1 Region: 12-186
Classification Level Classification E-value
Superfamily S-adenosyl-L-methionine-dependent methyltransferases 5.58e-28
Family TrmB-like 0.061
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_013995891.1.951
Sequence length 193
Comment O-methyltransferase [Zobellia galactanivorans]; AA=GCF_000973105.1; RF=representative genome; TAX=63186; STAX=63186; NAME=Zobellia galactanivorans; strain=DsiJT; AL=Complete Genome; RT=Major
Sequence
MLDSQISDQPKIYQEIQRKSKEVGFTMPSDLYVGSLLKTLMLSKPNGRFLEMGTGIGLSL
SWMIDGMGPDSSLVSVDNDSDLIEIVSEYFGADERVELICQDGSDWIRSYEGGHFDLIFA
DAWPGKYSEIDETLRLLAIGGFYVVDDMAVQPNWPEGHEDNVGRLIGYLEGRDDFVLTKL
DWSTGLIVAVKTK
Download sequence
Identical sequences G0L474
gi|340620530|ref|YP_004738983.1| WP_013995891.1.951

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]