SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_013997779.1.55458 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_013997779.1.55458
Domain Number 1 Region: 1-126
Classification Level Classification E-value
Superfamily YjgF-like 3.3e-45
Family YjgF/L-PSP 0.0000224
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_013997779.1.55458
Sequence length 126
Comment RidA family protein [Capnocytophaga canimorsus]; AA=GCF_000220625.1; RF=representative genome; TAX=860228; STAX=28188; NAME=Capnocytophaga canimorsus Cc5; strain=Cc5; AL=Complete Genome; RT=Major
Sequence
MKKQIIFTEKAPAPIGPYNQAVLAGNTLYVSGQIPVDPQTGEVVKGVEKATKQVMENLKA
VLEVAGATFENVVKTTIFLTDMNDFAQVNAIYGEYFDDATAPARETVQVANLPKFVEVEI
SCIAIL
Download sequence
Identical sequences A0A0B7IIJ6 F9YRZ3
gi|340622449|ref|YP_004740901.1| WP_013997779.1.42114 WP_013997779.1.48300 WP_013997779.1.55458 WP_013997779.1.64822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]