SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014002541.1.38903 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014002541.1.38903
Domain Number 1 Region: 3-137
Classification Level Classification E-value
Superfamily Molybdopterin synthase subunit MoaE 2.48e-46
Family Molybdopterin synthase subunit MoaE 0.0000409
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014002541.1.38903
Sequence length 156
Comment molybdopterin converting factor [Acidithiobacillus caldus]; AA=GCF_001650235.1; RF=na; TAX=33059; STAX=33059; NAME=Acidithiobacillus caldus; strain=MTH-04; AL=Contig; RT=Major
Sequence
MLVRVQEADFDPAEILTAELPNACGAVVSFVGTVRDYSESSDILALEIEHYPGMTERELQ
RLQQEAARRFAILDSAIVHRFGRLGPSERIVLVAVWSSHRAAAFDACRFLIDVLKTSAPF
WKKEITPTGARWVTDCPGCRAGTRHGHVHPDVLQES
Download sequence
Identical sequences A0A1E7YUX7 F9ZL30
gi|340781650|ref|YP_004748257.1| WP_014002541.1.38903 WP_014002541.1.41243 WP_014002541.1.50163 WP_014002541.1.58346 WP_014002541.1.8941

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]