SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014010042.1.39090 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014010042.1.39090
Domain Number 1 Region: 115-294,418-587
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 9.16e-100
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.00000000768
Further Details:      
 
Domain Number 2 Region: 291-413
Classification Level Classification E-value
Superfamily GAD domain-like 5.89e-34
Family GAD domain 0.00048
Further Details:      
 
Domain Number 3 Region: 2-104
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 4.38e-31
Family Anticodon-binding domain 0.00012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014010042.1.39090
Sequence length 600
Comment aspartate--tRNA ligase [Corynebacterium variabile]; AA=GCF_000179395.2; RF=representative genome; TAX=858619; STAX=1727; NAME=Corynebacterium variabile DSM 44702; strain=DSM 44702; AL=Complete Genome; RT=Major
Sequence
MLRTHLCGDLRSDDTGKEVTLTGWVARRRDHGGVIFIDLRDRSGLAQVVFRENEVAERAH
DLRSEYCLKVTGIVEARPEGSENPNLASGAIEVNVSDLEILNESTALPFQIEDTTGGEVG
EETRLKYRYLDLRRERQAHALRLRSKVSQAARGVLSGEDFTEIETPTLTRSTPEGARDFL
VPARLRPGSFYALPQSPQLFKQLLMVAGMERYYQIARCYRDEDFRADRQPEFTQLDVEMS
FVDQDDVIALAENILTAVWKEIGYDIQTPIPRMTYAEAMEKYGSDKPDLRFDIQITECTE
FFKDTSFRVFKAPYVGAVVMEGGASQPRRTLDAWQEWAKQRGAKGLAYILVGEDGTLTGP
VAKNITDAEREGIAAHVGAKPGDCIFFGAGEVKPSRALLGAARGEIAERLGLIKEGDWAF
TWVVDAPLFEPAADATASGDVALGHSTWTAVHHAFTSPKPEWIDSFDENPGEATAYAYDI
VCNGNEIGGGSIRIHQRDVQERVFAVMGISEEEAREKFGFLLDAFAFGAPPHGGIAFGWD
RIVSLLGGYESIRDVIAFPKSGGGVDPLTEAPAPITAQQRKEAGIDAKPKKPEAAAPAAE
Download sequence
Identical sequences G0HE10
gi|340794487|ref|YP_004759950.1| WP_014010042.1.39090

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]