SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014017650.1.90944 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014017650.1.90944
Domain Number 1 Region: 12-108
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 1.83e-25
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014017650.1.90944
Sequence length 115
Comment PTS lactose/cellobiose transporter subunit IIA [Borreliella bissettii]; AA=GCF_000222305.1; RF=representative genome; TAX=521010; STAX=64897; NAME=Borreliella bissettii DN127; strain=DN127; AL=Complete Genome; RT=Major
Sequence
MTKKTYSIEELIDKISMPVVAYSGEAKSFLREALEYAKNKEYDKAELAIQESKKSIAKAH
EAHREIIHQSATNPNSVKAPFILIHAEDHLMSAISESSIFEELINVYKIINEIKN
Download sequence
Identical sequences A0A1L8ZAG7 G0AMT6
WP_014017650.1.90944 WP_014017650.1.9618 gi|343126951|ref|YP_004770326.1|NC_015907 gi|343126951|ref|YP_004770326.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]