SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014026609.1.63292 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014026609.1.63292
Domain Number 1 Region: 37-408
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.39e-71
Family L-arabinose binding protein-like 0.0017
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014026609.1.63292
Sequence length 480
Comment ABC transporter substrate-binding protein [Pyrolobus fumarii]; AA=GCF_000223395.1; RF=representative genome; TAX=694429; STAX=54252; NAME=Pyrolobus fumarii 1A; strain=1A; AL=Complete Genome; RT=Major
Sequence
MRMVVWRALLLLALLAVAALAIPVAAEEKNVIVIGLTKSSGKYERESTEQLRGILLWAKW
VNETGGIKVGDKTYYVRIVYYDDQSKKDLVQQLYEKLITQDKVDFLFSPYSSGLSMAAVP
IAEKYGVPIVVVGAASDKIFTDLKPKCAFQIYTPASKYLTSSLDLVKKYMPNAKVYILYE
DTTFAATVAEAAKAYAEKIGLEVVGYESYPRDVKDFTAALERVRASGATVLIGGGHYRDG
LLLAKQIRELGLDEQLKFVSLLVAVDLPSFYKDMGEAANGFAGPSQWEPKVKYTPELAKK
LGIKWIGPTVDEFVKMYREAYGTDPGYHAAGGFAAGLFLQAAIEAAGSIDRMAVCNAAKK
LDILTFFGRLAVDPETGLQVAHEMVVVQWQNGAKEVIWPESAATAKPITLKGEPLAPAKE
QVKEQTTSVATETPATRAKTTPSTTTAEAATGTDMTIIIIGVIVAIIVLGFLAWYIRARE
Download sequence
Identical sequences G0EF35
gi|347523614|ref|YP_004781184.1| WP_014026609.1.63292

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]