SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014044270.1.79727 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014044270.1.79727
Domain Number 1 Region: 1-196
Classification Level Classification E-value
Superfamily DhaL-like 8.63e-52
Family DhaL-like 0.0000465
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014044270.1.79727
Sequence length 205
Comment MULTISPECIES: dihydroxyacetone kinase subunit L [Streptomyces]; AA=GCF_000382745.1; RF=na; TAX=1155717; STAX=1155717; NAME=Streptomyces sp. DvalAA-83; strain=DvalAA-83; AL=Contig; RT=Major
Sequence
MLDTDFFRRWMTATASAVDREADRLTGLDSAIGDADHGSNMRRGFGAVTDVLEKESPGTP
GAVLVLAGRQLISTVGGASGPLYGTLLRRTGKALGDAAEVSLDELAEAFGAGVAAVAQLG
GAKAGDKTMLDALLPAVEALGESVGAAGDAALAGALATVPLRARKGRASYLGERSIGHED
PGAASAALLVAALAEAAGTGDGGRA
Download sequence
Identical sequences G2NB77
gi|344997964|ref|YP_004800818.1| WP_014044270.1.39937 WP_014044270.1.47793 WP_014044270.1.79727

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]