SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014051591.1.75361 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014051591.1.75361
Domain Number 1 Region: 2-118
Classification Level Classification E-value
Superfamily Globin-like 5.11e-34
Family Truncated hemoglobin 0.00042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014051591.1.75361
Sequence length 120
Comment globin [halophilic archaeon DL31]; AA=GCF_000224475.1; RF=representative genome; TAX=756883; STAX=756883; NAME=halophilic archaeon DL31; strain=DL31; AL=Complete Genome; RT=Major
Sequence
MSQESLYDAIGGRDAVELVVDDFYNRVLDDPLLVPYFEDTDMDALFSHQVQFVSAVAGGP
VAYDGEDMQSAHDGMGITEEAFDHVAEHLDAALRENGVEGASAEAIIEEVAALEDDVVGQ
Download sequence
Identical sequences G2MLY7
WP_014051591.1.75361 gi|345005334|ref|YP_004808187.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]