SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014051641.1.75361 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014051641.1.75361
Domain Number 1 Region: 2-246
Classification Level Classification E-value
Superfamily Metallo-dependent phosphatases 1.14e-48
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), N-terminal domain 0.00055
Further Details:      
 
Domain Number 2 Region: 260-450
Classification Level Classification E-value
Superfamily 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 1.7e-36
Family 5'-nucleotidase (syn. UDP-sugar hydrolase), C-terminal domain 0.00063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014051641.1.75361
Sequence length 464
Comment 2',3'-cyclic-nucleotide 2'-phosphodiesterase [halophilic archaeon DL31]; AA=GCF_000224475.1; RF=representative genome; TAX=756883; STAX=756883; NAME=halophilic archaeon DL31; strain=DL31; AL=Complete Genome; RT=Major
Sequence
MVRLLHYSDIENIYDDAERAGRFAGRLAELDGDDALVVGTGDNTAPGVVSLAARGRQALD
LVSVVGTTADTFGNHDFDYGPDETRALVEASENTWVSANVRDEDGGPFAAAEGAVPWTIA
EADGERVGFFGLTDPATDSINPQAAPITLTDPYEAAEQAVADLRAEGVDYVVALSHLGGG
DDELARRVDVDAVLGGHVHSIRTEFVGDTLCTRPGVNGHNFIEITLEGDEASTRVVDPSE
GPVHEELREALQRRREAAGLTEVVATAAEPFERTEETTFGGESRIGNFVADAYRAAGDAD
VGLQNGGGIREGHPLHGEVTLADLVSVLPFEEPVVVVELTGEELRRALSEADGERLDFGE
PHWWHAHLSGAELVWDDEANEIVEATVGGEPIDPDRRYRVATAEYLLHSDHEFPTIEERH
RAGELGIQHDVLAAHARDGGLEVAVEGRIEFVRRGADQQDAPAE
Download sequence
Identical sequences G2MM37
WP_014051641.1.75361 gi|345005384|ref|YP_004808237.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]