SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014054115.1.85068 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  WP_014054115.1.85068
Domain Number - Region: 3-150
Classification Level Classification E-value
Superfamily Prim-pol domain 0.000301
Family Bifunctional DNA primase/polymerase N-terminal domain 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014054115.1.85068
Sequence length 279
Comment DNA primase [Streptomyces violaceusniger]; AA=GCF_000147815.2; RF=na; TAX=653045; STAX=68280; NAME=Streptomyces violaceusniger Tu 4113; strain=Tu 4113; AL=Complete Genome; RT=Major
Sequence
MSGHLHTALRLAAEGLPVLPLRKGKVPFGNCPACARNACGGRPNMKTPGPCICPDPCHAW
AAATTDPSVIASPAWAPAWREALTVAYHPGGAGLTVVDLDNAAAVAWARETLPATRTVAT
TRGEHWIYQGAMRSVNAVRDGVDIKSTMAYARWLGPGTGTMTSLPAVVRALAVKEPSTVR
QAPHAVTVPAWAGEGACRHRTPTYLDRGIAMAEQRITEARSAVHATVYRTFLAVLSTHGR
CGCLTEAHIARLFTAAQAKGESPRHCTDAWTNARTTLGL
Download sequence
Identical sequences G2PA87
WP_014054115.1.85068 gi|345008521|ref|YP_004810875.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]