SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014064294.1.68312 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014064294.1.68312
Domain Number 1 Region: 180-522
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 1.53e-112
Family Proline dehydrohenase domain of bifunctional PutA protein 0.00000000263
Further Details:      
 
Domain Number 2 Region: 563-1002
Classification Level Classification E-value
Superfamily ALDH-like 8.77e-106
Family ALDH-like 0.00000126
Further Details:      
 
Domain Number 3 Region: 11-179
Classification Level Classification E-value
Superfamily N-terminal domain of bifunctional PutA protein 9.55e-50
Family N-terminal domain of bifunctional PutA protein 0.000016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014064294.1.68312
Sequence length 1150
Comment bifunctional proline dehydrogenase/L-glutamate gamma-semialdehyde dehydrogenase [Haemophilus parainfluenzae]; AA=GCF_000210895.1; RF=na; TAX=862965; STAX=729; NAME=Haemophilus parainfluenzae T3T1; strain=T3T1; AL=Complete Genome; RT=Major
Sequence
MSFQLSKTYRPERQLITENYRLDEKTAVDNLLKTLDFTQEQEKRITDNAIKLINKLRHLK
QKQYGADALMQEFSLSSEEGVALMCLAEALLRIPDAETRDDLIYEKLRDGNWKSHIGNAN
SFFINAASYGLVFGKKISENLDEKSLANALSRSFARFSAPIMRTLIVKSMQILGKQFVTG
VTMQEALTNIKPRYEKGFTFSFDMLGEAAMTQADADRYFNDYLHAIESVGKDAAGRTIYN
GNSVSVKLSAIHPKYWRAKYDRVIDELYPRVKELFLLAKKYNISVNIDAEEASRLELSLD
LVEKLLDEPELKGYKGIGYVVQAYSKRCPFVLDYLINLAREKDGYLMIRLVKGAYWDSEV
KWAQADGLDGFPLYTRKNHTDISYIACAKKLLAAQDVIYPQFATHNVQTMCTIHELGQGK
QFEFQCLHGMGESLYDNIVGKENFNRQVRVYAPVGTHETLLAYLVRRLLENGANSSFVHQ
LVDENIPVEQLVIPPWKLYEKSNGEPNKLVRNPLELFSDRRNSAGFDLSNEFELAKLEQA
LNEAPIENAQSLTVLAHAENLAAHTVVNPANLKENLAEVAFLNPTEAQAVFNAANNETWA
AQSATERANVLRKAADLYEENFGLLMKLAIVEAGKTLPNAIAELREAVDFLRYYANQLEY
FAKDQHLGAPRGKVLCISPWNFPLAIFTGQVAASLAAGNAVIAKPAEQTSLIAYAAVKLL
HQAGVPKEALQLVLGAGDLGAALVQQAFDGVVFTGSTEVAKLIEKRIAQADNDPVLIAET
GGQNVLVSDSSALPEQVVADVLSSAFDSAGQRCSALRILLLQEDVADHYYKIITEAINEF
SLGDPRLLSTDIGPVIDQEAKQNLENHKANMRKVARAYVELEAPTNGHFVAPAVYLLDNL
NQLQREVFGPILHIVRYKKENLVNVLNEVNAKGYALTGGCHSRIRKQMDLVEKHLHCGNF
YINRNIVGAVVGVQPFGGHGLSGTGPKAGGEFYLQRLTKTDRYYSQFGDENTLGNAQPVL
DSITGERNSLAYLPSEVAILNGDLAASEKAANKLLAKGFTILVEPSHPLAKSGKAGVRVD
TKLGHCQKGIYLAELSKERRQWLAENSSAIFKCYDWQTTQDILPLYDEFSRSYNTTAAGG
NTSLMSSEEH
Download sequence
Identical sequences E1W297
WP_014064294.1.68312 gi|345428962|ref|YP_004822078.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]