SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014072502.1.92079 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014072502.1.92079
Domain Number 1 Region: 4-304
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 9.81e-81
Family ADP-ribosylglycohydrolase 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014072502.1.92079
Sequence length 312
Comment ADP-ribosylglycohydrolase [Rhodothermus marinus]; AA=GCF_000565305.1; RF=na; TAX=762569; STAX=29549; NAME=Rhodothermus marinus SG0.5JP17-171; strain=SG0.5JP17-171; AL=Contig; RT=Major
Sequence
MGEQSRFRGCLLGLAIGDALGTTLEFRRPGTFEPLTDMVGGGPFNLPPGYWTDDTSMALC
LAASLLECDGFDPVDQLRRYVRWWREGYLSSTGRCFDIGNTVRRALQRFEEIGEAFPGPT
DPWSAGNGSIMRLAPVPMFYFRNPQLAIEMAACSSQTTHGSREAIDACRYLCALILGALQ
GVPKAELLAPHYCPIPNYWEQHPLAERIDEVAAGSFKARQPPEIRGSGYVVHTLEAALWA
FYRSKTFEEGCLMVVNLGEDADTTGAVYGQLAGAYYGAQGIPEHWLARLAHRPLIEDFAD
RLYWRTLNDGAQ
Download sequence
Identical sequences G2SLH2
gi|345301806|ref|YP_004831000.1| WP_014072502.1.101848 WP_014072502.1.92079 gi|345301806|ref|YP_004831000.1|NC_015970

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]