SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014075905.1.10870 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014075905.1.10870
Domain Number 1 Region: 33-124
Classification Level Classification E-value
Superfamily YccV-like 9.94e-34
Family YccV-like 0.0011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014075905.1.10870
Sequence length 136
Comment DNA-binding protein [Sphingobium sp. SYK-6]; AA=GCF_000283515.1; RF=na; TAX=627192; STAX=627192; NAME=Sphingobium sp. SYK-6; strain=SYK-6; AL=Complete Genome; RT=Major
Sequence
MKQSPNDKRNAIPPELAAALPGALGAAPRIAHARFRIGDTVRHRMFGFRGVVFDIDPVFA
NSEEWYEAIPVAARPPRDQPFYHLFADNGESSYVAYVSQQNLVADETGDPIDHPAIDALF
ERKADGGYALGASRWH
Download sequence
Identical sequences G2IS94
WP_014075905.1.10870 gi|347527964|ref|YP_004834711.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]