SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for WP_014079339.1.73573 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014079339.1.73573
Domain Number 1 Region: 8-105
Classification Level Classification E-value
Superfamily Enzyme IIa from lactose specific PTS, IIa-lac 9.68e-29
Family Enzyme IIa from lactose specific PTS, IIa-lac 0.00058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014079339.1.73573
Sequence length 115
Comment phosphotransferase system PTS lactose/cellobiose-specific transporter subunit IIA [Roseburia hominis]; AA=GCF_000225345.1; RF=representative genome; TAX=585394; STAX=301301; NAME=Roseburia hominis A2-183; strain=A2-183; AL=Complete Genome; RT=Major
Sequence
MDEIDETEQQREAAMEIIAKAGAAKSCAFAAIHRAKDFDFAGAAEQLDEAERYATEAHKV
HTDLLVREAGGQQTDAGLLMTHAQDHFMMATLAQEMAEEIVDVYRALEEAKGGSR
Download sequence
Identical sequences G2SWL0
WP_014079339.1.73573 gi|347531463|ref|YP_004838226.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]