SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014083899.1.101872 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014083899.1.101872
Domain Number 1 Region: 217-407
Classification Level Classification E-value
Superfamily PheT/TilS domain 2.04e-71
Family B3/B4 domain of PheRS, PheT 0.00000435
Further Details:      
 
Domain Number 2 Region: 44-202
Classification Level Classification E-value
Superfamily Nucleic acid-binding proteins 1.91e-40
Family Myf domain 0.0041
Further Details:      
 
Domain Number 3 Region: 708-806
Classification Level Classification E-value
Superfamily Anticodon-binding domain of PheRS 1.12e-28
Family Anticodon-binding domain of PheRS 0.0013
Further Details:      
 
Domain Number 4 Region: 480-701
Classification Level Classification E-value
Superfamily Class II aaRS and biotin synthetases 4.52e-27
Family Class II aminoacyl-tRNA synthetase (aaRS)-like, catalytic domain 0.002
Further Details:      
 
Domain Number 5 Region: 416-488
Classification Level Classification E-value
Superfamily Putative DNA-binding domain 0.00000000000000311
Family Domains B1 and B5 of PheRS-beta, PheT 0.0045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014083899.1.101872
Sequence length 806
Comment phenylalanine--tRNA ligase subunit beta [Flavobacterium branchiophilum]; AA=GCF_000253275.1; RF=representative genome; TAX=1034807; STAX=55197; NAME=Flavobacterium branchiophilum FL-15; strain=FL-15; AL=Complete Genome; RT=Major
Sequence
MKISYNWLKQFIKIDWKSEETAALLTDLGLEVETVDKFQSLKGGLEGVVVGQILTFEQHP
NADKLKVTIVDIGAENSLQIVCGASNVAIGQKVLVATIGTVLYDKEGKEFTIKKGKIRNM
ESHGMICAEDELGLGDSHDGIMILEDKWPVGTPAAKVFQIENDEVFEIGLTPNRADAMSH
LGTARDLRAGMLQSGVHVELITPSISNFRVDKKILKIDADVLNTKLVPRYCGVTLSGLTI
KPSPEWLQNRLKAIGINPKNNVVDVTNYVLHELGQPLHAFDANKISGKILVKTVDSGSKF
TTLDEVERTLHEEDLMICDEKGPLCIAGVFGGIKSGVTENTTSIFLESAYFNPVSIRKTA
KRHGLNTDASFRFERGIDPNITVYALKRAALLIKEVAGGEITSDIIDNYPKKIEDFTVFL
NFERTNKLIGQSLPKENIKKILASLDIKINSETEIGLGLVIPSYRVDVQREVDVIEEILR
VYGYNNIQFSKKLHATTFNAARTEDYKVQNIIASQLNANGFHEMMANSLTTSNYIQLSEN
LNEAHNVSILNPLSNDLATMRQSLLFSGLEAVSFNINRKNTDLKLFEFGKSYHQFDKGYQ
ENKHLTLFVSGNRNSQNWTNQSMKSDFFMFKSIINSIFSRLGIQKLQNKTLTSDVFSEGM
SYTLGNEVLVEFGTIKKPIVKHFDIKQEVLFADFNWNAILKVISNKIKFIEIPKYPEVRR
DLSLLLDEQVAFEHIYKIARLSEKILLKEIDLFDVYQGKNLPEGKKSYAVSFILQDNSKT
LTDQQIDKVMDKIQFNLINELGAVLR
Download sequence
Identical sequences G2Z7N5
gi|347536244|ref|YP_004843669.1| WP_014083899.1.101872

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]