SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014086678.1.76262 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014086678.1.76262
Domain Number 1 Region: 634-801
Classification Level Classification E-value
Superfamily Nitrite and sulphite reductase 4Fe-4S domain-like 7.72e-50
Family Nitrite and sulphite reductase 4Fe-4S domain-like 0.00084
Further Details:      
 
Domain Number 2 Region: 3-192
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 2.81e-44
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0017
Further Details:      
 
Domain Number 3 Region: 143-311
Classification Level Classification E-value
Superfamily FAD/NAD(P)-binding domain 1.13e-29
Family FAD/NAD-linked reductases, N-terminal and central domains 0.0023
Further Details:      
 
Domain Number 4 Region: 508-642
Classification Level Classification E-value
Superfamily Nitrite/Sulfite reductase N-terminal domain-like 1.34e-25
Family Duplicated SiR/NiR-like domains 1 and 3 0.026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) WP_014086678.1.76262
Sequence length 810
Comment nitrite reductase large subunit [Pseudogulbenkiania sp. NH8B]; AA=GCF_000283535.1; RF=na; TAX=748280; STAX=748280; NAME=Pseudogulbenkiania sp. NH8B; strain=NH8B; AL=Complete Genome; RT=Major
Sequence
MNKPKLVMVGNGMAGVRTLEELLKLMPDFYDITVFGAEPHPNYNRILLSPVLSGEQTLKE
IMLNEVEWYAENGITLHMGKEVTEIDRVKRVVRTSDGTEAPYDRLLLATGSNPFILPVPG
KDLDGVVTFRDIRDVNLMIEASQTYKKAVVIGGGLLGLEAANGLMARGMEVSVVHLGEWL
LDRQLDRTAAKLLQQSLEDRGIAFHLQKQTAALLDNGTGRVAGLRFADGEEIPGDLVVMA
VGIRPNAELAEKSGLYCNRGVVVNDTMQTYDPRVYAVGECVSHRGVAYGLVAPLFDMAKV
AANHLAHYGIGRYVPAATSTKLKVTGIDLFSAGDFMGDDGTEAITLSDPMGGLYKKLVLK
DNKLVGACLYGDTADGAWYFRLIREGKSVAEMRDVLMLGEGGQGDVGHAGQSKVVGMPDD
AEVCGCNGVCKGTIVKAIQEKGLFTVDEIKKHTKAASSCGSCTGLVEQILINCVGGAADV
KPKSEKPVCGCTEHTHGGVRKVIREQHLTSLRQVMDFLEWRTPDGCATCRPAINYYLIST
WPGEAKDDPQSRFINERVHANIQKDGTYSVIPRMWGGVTNASELRRIADVADKYAIPMVK
VTGGQRIDLLGVKKEDLPKVWADLDMPSGHAYGKSLRTVKTCVGSEFCRFGTQDSTQMGI
DLEKDLTGMWSPAKVKLAVSGCPRNCAESGIKDVGIIGVDSGWELYIGGNGGIKTEVAQF
LAKVKTREEVLELSGAFLQLYREEAFYLERTVHYLHRVGLDFIKAQVVDNLENRKALYER
LRFALSFEKDPWTERVKEGVARHEFEPLTV
Download sequence
Identical sequences G2J2B9
WP_014086678.1.76262 gi|347539284|ref|YP_004846709.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]