SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014093373.1.18800 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014093373.1.18800
Domain Number 1 Region: 194-616
Classification Level Classification E-value
Superfamily beta-lactamase/transpeptidase-like 4.51e-92
Family beta-Lactamase/D-ala carboxypeptidase 0.00000129
Further Details:      
 
Domain Number 2 Region: 56-242
Classification Level Classification E-value
Superfamily Penicillin binding protein dimerisation domain 1.16e-44
Family Penicillin binding protein dimerisation domain 0.0000228
Further Details:      
 
Domain Number 3 Region: 603-657
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.00000000000497
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0057
Further Details:      
 
Domain Number 4 Region: 659-713
Classification Level Classification E-value
Superfamily Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.0000000000144
Family Penicillin-binding protein 2x (pbp-2x), c-terminal domain 0.002
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014093373.1.18800
Sequence length 752
Comment penicillin-binding protein 2B [Listeria ivanovii]; AA=GCF_000763515.1; RF=na; TAX=202751; STAX=1638; NAME=Listeria ivanovii subsp. ivanovii; strain=WSLC 3010; AL=Complete Genome; RT=Major
Sequence
MKRRIGNMRRGALVLFIFFTILFLLVSGRFLYLQIVGEANGVPLAAKASKQHLKSSVLEA
KRGSILDRKGEVLAEDTASYTVAAVVSDKLPKTTKNPMRVVDEEKTAQVLAKYIPMDESD
ILDKLNEKGKYQVEFGAAGKNISTETKAKIEKENLPGIEFTRQSERFYPNGTFATQLIGF
AQQEEEKNKSVLEGKMGIESRFNEALTGTNGKIDYSTDRMGYILPNSKNKVTKAKDGKDI
TLTLDKKIQTFLEDTMTTVDAKYNPKNMMAVVADPKTGEILAISQRPSFNPADRSTITGN
SSSIWQDLPVEYAYEPGSVMKIISLASAIDTNVYNPNEYYQSGSYKVGDIAIHDHNNGVG
WGSIPYREGVERSSNVAFAKLLNKMGTDTFHTYLDKFGFGKKTGIDLPNETSGKILYNYP
IEKVTTVFGQGTTVSMMQMIQAASAIASDGTMKQPYVVSKVTDPNTGKETETKTTTAGKP
ISAATAKKTRDELKNVISGEHGTGKLYAIPGYDVAGKTGTSQIPNPKTGKYMTGANNYIF
SFLGMAPADDPELVIYVTMQQPQLSGSETGGEAVSEVFNPVMKNSLQYMNIKPGDVEKLA
SEKVPVVTEKTVTDAKKTVTAKGLEAVVVGNGKKIVQQLPQANSDLMQGQKVILMTDGDM
TAPDMVTWSKDDALKVSEITGIPFEFSGSGYVKSQSVSAGSVINSDTKMKITLAPPEQIS
QFNQNHDQDQAEKNKKATDIQENAGIGDLLNQ
Download sequence
Identical sequences G2ZD50
gi|347549435|ref|YP_004855763.1| WP_014093373.1.18800 WP_014093373.1.69764 WP_014093373.1.77720 WP_014093373.1.92350

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]