SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014098732.1.73878 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014098732.1.73878
Domain Number 1 Region: 6-374
Classification Level Classification E-value
Superfamily Homocysteine S-methyltransferase 4.32e-107
Family Homocysteine S-methyltransferase 0.00000104
Further Details:      
 
Domain Number 2 Region: 323-616
Classification Level Classification E-value
Superfamily FAD-linked oxidoreductase 8.04e-71
Family Methylenetetrahydrofolate reductase 0.00025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014098732.1.73878
Sequence length 620
Comment bifunctional homocysteine S-methyltransferase/methylenetetrahydrofolate reductase [Chloracidobacterium thermophilum]; AA=GCF_000226295.1; RF=representative genome; TAX=981222; STAX=458033; NAME=Chloracidobacterium thermophilum B; strain=B; AL=Complete Genome; RT=Major
Sequence
MKVLKPFRELLAADGIHVFDGAMGTLLYAKGVYVNRCYDEISLSNPALVQEVHREYVKAG
AEIVQTNTFGANRPKLEMHGFQDRVQEINYKAAKLAREAVGPQVYVAGSIGPLGIRIEPW
GPTSFDEAKAFFREQAEALLDGGVDLIVLETFTDLTEIRQALAAVRELSADMVVVAQMTV
GEDGATGYGTAPEIFTKRLDEWGADVIGLNCSVGPKPMLEAIERMAAVTEKPLSAQPNAG
LPQDLQGRKIYLCSPEYMAKYARRLIQSGVRFIGGCCGTTPEHIKTLKAAVRALSPAKRI
EPVIQVLETKCPDVRITPPEEKSRFARKIVQGEFVTSVEIVPPRGCDPTKMLEGVRLLKA
AGVDAVNVPDGPRAQSRMGAIATSLIIEQQVGIETVTHYCCRDRNLLGMTSDLLGAAALG
LRNILLITGDPPKMGPYPDATAVFDIDSIGLTNMVKRLNLGLDLGGNAIGQPTSYFIGVG
VNPCAVDLDYEIRRFEYKVEAGAEFAITQPIFDIGMFRAFLKRIEHCRIPIIAGIWPLTS
YRNAEFLSNEVPGVVVAPEILERMRRANTSPEAGQQEGLAIAREMLSEVRDLVQGVQVSA
PFGRVAYALEVFEVLRETVG
Download sequence
Identical sequences G2LHT4
WP_014098732.1.73878 gi|347753946|ref|YP_004861510.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]