SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014111319.1.32922 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014111319.1.32922
Domain Number 1 Region: 65-350
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.26e-72
Family Phosphate binding protein-like 0.00000344
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) WP_014111319.1.32922
Sequence length 353
Comment C4-dicarboxylate ABC transporter substrate-binding protein [Taylorella asinigenitalis]; AA=GCF_000226625.1; RF=representative genome; TAX=1008459; STAX=84590; NAME=Taylorella asinigenitalis MCE3; strain=MCE3; AL=Complete Genome; RT=Major
Sequence
MKLFKTTSILAFVLVALAACGEKEDTNKTTSKTETTTTETKTVTQETKAPETSSDTAKSE
GLETKFVTIATGGASGPYNIIATTLADEYNKAYGVNSKTQTTGASVENANLVGGGKVEMA
FLMSDILSDAVKGQNSFKQPVETIRQMAVLYPNFVQVVTSKDSGINTLADIKGKRVSVGA
PGSGTEANARNLIEGFGMTYNDIKVDYLGYAESADALKTGKVDVAFLTSGLPNASLLELS
RSFPMKLVSVPAEKLKEIADKAPYFSSKEIPAGTYGNDEPVTTAVIRNAIIVSSKLSDDD
VYKLTKTFIEKLPNLQNSHQAIKAVDSKSAQEGMVAPIHPGAKKYYDELNAKQ
Download sequence
Identical sequences G4QAW2
WP_014111319.1.32922 gi|348589983|ref|YP_004874445.1|

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]