SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for WP_014118103.1.66763 from NCBI 2017_08 genome

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  WP_014118103.1.66763
Domain Number 1 Region: 24-115,248-466
Classification Level Classification E-value
Superfamily Zn-dependent exopeptidases 8.6e-91
Family Bacterial dinuclear zinc exopeptidases 0.000000789
Further Details:      
 
Domain Number 2 Region: 116-247
Classification Level Classification E-value
Superfamily Aminopeptidase/glucanase lid domain 4.3e-31
Family Aminopeptidase/glucanase lid domain 0.0000146
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) WP_014118103.1.66763
Sequence length 469
Comment aminopeptidase [Oscillibacter valericigenes]; AA=GCF_000283575.1; RF=representative genome; TAX=693746; STAX=351091; NAME=Oscillibacter valericigenes Sjm18-20; strain=Sjm18-20; AL=Complete Genome; RT=Major
Sequence
MAEDKKMKELREKLLSGKKNGYDKFDVKEEKAMESYCADYKAFLDAGKTERECAAELVRL
AEKVGFKPFARGMKLKAGDKLYFRNRGKSVYLACIGKKPLSQGAQIAAAHIDSPRLDLKP
NPMYEDSELCYFKTHYYGGIRRYQWTTVPMELHGVVALKNGEVIHLNIGADEGDPKLVIT
DLLPHLGAEQNKKPLSEAVPGEMLNLLLGSRPLPEGEGSDKVKLAVMQLLNEKYGITEDD
FTSAELEAVPAAKACDIGLDRSMIGAYGHDDRVCAYAAFRALLDLKKTPEKTAVCILADK
EEIGSDGVTGMQSAAFDTFMEDLCEAQDVPVRVCLEKSFCLSADVTAAFDPNFADVFEKR
NSALINYGIGLCKYTGARGKSGASDADAETVAYVRSLFDEANVIWQIAELGKVDAGGGGT
VAMYMANRNIATMDAGVPVLSMHSPFETVAKLDCYETYKGMTAVFQAKN
Download sequence
Identical sequences G4KPF3
gi|350270639|ref|YP_004881947.1| WP_014118103.1.66763

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]